MGC4172 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2112555
| Article Name: |
MGC4172 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2112555 |
| Supplier Catalog Number: |
orb2112555 |
| Alternative Catalog Number: |
BYT-ORB2112555-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human MGC4172 |
| Conjugation: |
FITC |
| Alternative Names: |
ARPG836, SDR24C1, spDHRS11 |
| MGC4172 Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
19kDa |
| NCBI: |
33637 |
| UniProt: |
Q6UWP2 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VETQFAFKLHDKDPEKAAATYEQMKCLKPEDVAEAVIYVLSTPAHIQIGD |
