LENG4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2112560
Article Name: LENG4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2112560
Supplier Catalog Number: orb2112560
Alternative Catalog Number: BYT-ORB2112560-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LENG4
Conjugation: HRP
Alternative Names: BB1, LRC4, LENG4, LPIAT, LPLAT, MBOA7, MRT57, OACT7, hMBOA-7
LENG4 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 077274
UniProt: Q96N66
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW