ELOVL5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2112811
Article Name: ELOVL5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2112811
Supplier Catalog Number: orb2112811
Alternative Catalog Number: BYT-ORB2112811-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ELOVL5
Conjugation: Biotin
Alternative Names: HELO1, SCA38, dJ483K16.1
ELOVL5 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 068586
UniProt: Q9NYP7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK