ISLR2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2112934
Article Name: ISLR2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2112934
Supplier Catalog Number: orb2112934
Alternative Catalog Number: BYT-ORB2112934-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ISLR2
Conjugation: Biotin
Alternative Names: LINX
ISLR2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 79kDa
NCBI: 065902
UniProt: Q6UXK2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PFHCGCGLVWLQAWAASTRVSLPEPDSIACASPPALQGVPVYRLPALPCA