SEMA6A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2112940
Article Name: SEMA6A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2112940
Supplier Catalog Number: orb2112940
Alternative Catalog Number: BYT-ORB2112940-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SEMA6A
Conjugation: Biotin
Alternative Names: VIA, SEMA, HT018, SEMAQ, SEMA6A1
SEMA6A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 114kDa
NCBI: 065847
UniProt: Q9H2E6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ERVPKPRPGCCAGSSSLERYATSNEFPDDTLNFIKTHPLMDEAVPSIFNR