Fto Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2115649
Article Name: Fto Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2115649
Supplier Catalog Number: orb2115649
Alternative Catalog Number: BYT-ORB2115649-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: Biotin
Alternative Names: AW743446, mKIAA1752
Fto Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 036066
UniProt: Q8BGW1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MKRVQTAEEREREAKKLRLLEELEDTWLPYLTPKDDEFYQQWQLKYPKLV