TGM2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2115652
Article Name: TGM2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2115652
Supplier Catalog Number: orb2115652
Alternative Catalog Number: BYT-ORB2115652-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TGM2
Conjugation: Biotin
Alternative Names: TGC, tTG, G(h), hTG2, TG(C)
TGM2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 77kDa
NCBI: 004604
UniProt: P21980
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MAEELVLERCDLELETNGRDHHTADLCREKLVVRRGQPFWLTLHFEGRNY