SAC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2115685
Article Name: SAC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2115685
Supplier Catalog Number: orb2115685
Alternative Catalog Number: BYT-ORB2115685-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SAC
Conjugation: Biotin
Alternative Names: SAC, HCA2, SACI, Sacy, hsAC, HEL-S-7a
SAC Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 187kDa
NCBI: 060887
UniProt: Q96PN6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL