Them6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2115898
Article Name: Them6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2115898
Supplier Catalog Number: orb2115898
Alternative Catalog Number: BYT-ORB2115898-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse 4930572J05Rik
Conjugation: Biotin
Alternative Names: 4930572J05Rik
Them6 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 941009
UniProt: Q80ZW2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RRSLRLFEPFEVHTRLQGWDDRAFYLEARFVSLRDGFVCALLRFRQHVLG