TMEM9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2115949
Article Name: TMEM9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2115949
Supplier Catalog Number: orb2115949
Alternative Catalog Number: BYT-ORB2115949-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TMEM9
Conjugation: Biotin
Alternative Names: DERM4, TMEM9A
TMEM9 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 057540
UniProt: Q9P0T7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS