DNAJB11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2115958
| Article Name: |
DNAJB11 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2115958 |
| Supplier Catalog Number: |
orb2115958 |
| Alternative Catalog Number: |
BYT-ORB2115958-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human DNAJB11 |
| Conjugation: |
Biotin |
| Alternative Names: |
DJ9, EDJ, Dj-9, ERj3, PKD6, ABBP2, ERdj3, ERj3p, ABBP-2, UNQ537, PRO1080 |
| DNAJB11 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
40kDa |
| NCBI: |
057390 |
| UniProt: |
Q9UBS4 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: FDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQKVYNGLQGY |
