TMEFF2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2115982
Article Name: TMEFF2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2115982
Supplier Catalog Number: orb2115982
Alternative Catalog Number: BYT-ORB2115982-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMEFF2
Conjugation: Biotin
Alternative Names: TR, HPP1, TPEF, TR-2, TENB2, CT120.2
TMEFF2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 38kDa
UniProt: Q9UIK5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANK