TSPAN3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2116585
Article Name: TSPAN3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2116585
Supplier Catalog Number: orb2116585
Alternative Catalog Number: BYT-ORB2116585-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSPAN3
Conjugation: Biotin
Alternative Names: TM4-A, TM4SF8, TSPAN-3
TSPAN3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 944492
UniProt: O60637
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SRAIDYVQRQLHCCGIHNYSDWENTDWFKETKNQSVPLSCCRETASNCNG