TSPAN32 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2116597
Article Name: TSPAN32 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2116597
Supplier Catalog Number: orb2116597
Alternative Catalog Number: BYT-ORB2116597-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TSPAN32
Conjugation: Biotin
Alternative Names: ART1, PHMX, PHEMX, TSSC6
TSPAN32 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 005696
UniProt: Q96QS1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAR