TMPRSS2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2116602
Article Name: TMPRSS2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2116602
Supplier Catalog Number: orb2116602
Alternative Catalog Number: BYT-ORB2116602-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TMPS2
Conjugation: FITC
Alternative Names: PRSS10
TMPRSS2 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 005647
UniProt: O15393
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMM