NNAT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2116636
Article Name: NNAT Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2116636
Supplier Catalog Number: orb2116636
Alternative Catalog Number: BYT-ORB2116636-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NNAT
Conjugation: Biotin
Alternative Names: Peg5
NNAT Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 6
NCBI: 859017
UniProt: Q16517
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MAAVAAASAELLIIGWYIFRVLLQVFRYSLQKLAYTVSRTGRQVLGERRQ