DCC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2116651
Article Name: DCC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2116651
Supplier Catalog Number: orb2116651
Alternative Catalog Number: BYT-ORB2116651-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DCC
Conjugation: Biotin
Alternative Names: CRC18, CRCR1, MRMV1, HGPPS2, IGDCC1, NTN1R1
DCC Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 158kDa
NCBI: 005206
UniProt: P43146
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITVLVVVIVAVICTRRSSAQ