IL11RA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2116738
Article Name: IL11RA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2116738
Supplier Catalog Number: orb2116738
Alternative Catalog Number: BYT-ORB2116738-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IL11RA
Conjugation: Biotin
Alternative Names: CRSDA
IL11RA Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 004503
UniProt: Q14626
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDA