ATIC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2117257
Article Name: ATIC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2117257
Supplier Catalog Number: orb2117257
Alternative Catalog Number: BYT-ORB2117257-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATIC
Conjugation: Biotin
Alternative Names: PURH, AICAR, AICARFT, IMPCHASE, HEL-S-70p
ATIC Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 70527
UniProt: P31939
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT