GUCY1B1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2117410
| Article Name: |
GUCY1B1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2117410 |
| Supplier Catalog Number: |
orb2117410 |
| Alternative Catalog Number: |
BYT-ORB2117410-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the following sequence VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS |
| Conjugation: |
Biotin |
| Alternative Names: |
GUCB3, GC-SB3, GUC1B3, GUCSB3, GUCY1B3, GC-S-beta-1 |
| GUCY1B1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
71 kDa |
| NCBI: |
000848 |
| UniProt: |
Q02153 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: VTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENS |