GM2A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2117419
Article Name: GM2A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2117419
Supplier Catalog Number: orb2117419
Alternative Catalog Number: BYT-ORB2117419-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GM2A
Conjugation: Biotin
Alternative Names: SAP-3, GM2-AP
GM2A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 000396
UniProt: P17900
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRS