SNF1LK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2117452
Article Name: SNF1LK Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2117452
Supplier Catalog Number: orb2117452
Alternative Catalog Number: BYT-ORB2117452-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNF1LK
Conjugation: Biotin
Alternative Names: MSK, SIK, DEE30, SIK-1, SIK1B, SNF1LK
SNF1LK Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 85kDa
NCBI: 775490
UniProt: P57059
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTK