RIPK4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2117515
Article Name: RIPK4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2117515
Supplier Catalog Number: orb2117515
Alternative Catalog Number: BYT-ORB2117515-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RIPK4
Conjugation: Biotin
Alternative Names: DIK, PKK, PPS2, RIP4, ANKK2, NKRD3, ANKRD3, CHANDS
RIPK4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 86kDa
NCBI: 065690
UniProt: Q9H4D1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DGLFGTIAYLPPERIREKSRLFDTKHDVYSFAIVIWGVLTQKKPFADEKN