DONSON Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2117527
Article Name: DONSON Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2117527
Supplier Catalog Number: orb2117527
Alternative Catalog Number: BYT-ORB2117527-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DONSON
Conjugation: Biotin
Alternative Names: B17, MIMIS, MISSLA, C21orf60
DONSON Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 63kDa
NCBI: 060083
UniProt: Q9NYP3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE