Sumo3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2117557
| Article Name: |
Sumo3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2117557 |
| Supplier Catalog Number: |
orb2117557 |
| Alternative Catalog Number: |
BYT-ORB2117557-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Sumo3 |
| Conjugation: |
Biotin |
| Alternative Names: |
SMT, SMT3A, Smt3h, SUMO-3, Smt3h1, D10Ertd345, D10Ertd345e, 2810014B19Rik |
| Sumo3 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
12kDa |
| NCBI: |
064313 |
| UniProt: |
Q9Z172 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: PKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMR |
