DYRK1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2117608
Article Name: DYRK1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2117608
Supplier Catalog Number: orb2117608
Alternative Catalog Number: BYT-ORB2117608-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DYRK1A
Conjugation: Biotin
Alternative Names: MNB, DYRK, HP86, MNBH, MRD7, DYRK1
DYRK1A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 85kDa
NCBI: 001387
UniProt: Q13627
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: INEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWM