Dyrk1a Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2117611
| Article Name: |
Dyrk1a Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2117611 |
| Supplier Catalog Number: |
orb2117611 |
| Alternative Catalog Number: |
BYT-ORB2117611-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
Biotin |
| Alternative Names: |
Dyr, Mnb, mmb, Dyrk, Mnbh, Mp86, Gm10783, D16Ertd272, D16Ertd493, D16Ertd272e, D16Ertd493e, 2310043O08Rik |
| Dyrk1a Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
85kDa |
| NCBI: |
031916 |
| UniProt: |
Q63470 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: SFHAAGLQMAAQMPHSHQYSDRRQPNISDQQVSALSYSDQIQQPLTNQVM |
