ACVR2B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2118433
Article Name: ACVR2B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2118433
Supplier Catalog Number: orb2118433
Alternative Catalog Number: BYT-ORB2118433-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ACVR2B
Conjugation: Biotin
Alternative Names: HTX4, ACTRIIB, ActR-IIB
ACVR2B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 001097
UniProt: Q13705
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LCHVAETMSRGLSYLHEDVPWCRGEGHKPSIAHRDFKSKNVLLKSDLTAV