POMT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2118499
Article Name: POMT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2118499
Supplier Catalog Number: orb2118499
Alternative Catalog Number: BYT-ORB2118499-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POMT1
Conjugation: Biotin
Alternative Names: RT, LGMD2K, MDDGA1, MDDGB1, MDDGC1, LGMDR11
POMT1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 82kDa
NCBI: 001070833
UniProt: B3KQG0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LTFQILLLPVVLQHISDHLCRSQLQRSIFSALVVAWYSSACHVSNTLRPL