TMEM91 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2118535
Article Name: TMEM91 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2118535
Supplier Catalog Number: orb2118535
Alternative Catalog Number: BYT-ORB2118535-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM91
Conjugation: Biotin
Alternative Names: DSPC3, IFITMD6
TMEM91 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 001036060
UniProt: Q6P434
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFL