SPOCK3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2118568
Article Name: SPOCK3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2118568
Supplier Catalog Number: orb2118568
Alternative Catalog Number: BYT-ORB2118568-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPOCK3
Conjugation: Biotin
Alternative Names: TES-3, TICN3, HSAJ1454
SPOCK3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 001035249
UniProt: B3KR67
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKT