CEACAM16 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2118655
Article Name: CEACAM16 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2118655
Supplier Catalog Number: orb2118655
Alternative Catalog Number: BYT-ORB2118655-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CEACAM16
Conjugation: Biotin
Alternative Names: CEAL2, DFNA4B, DFNB113
CEACAM16 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 001034302
UniProt: Q2WEN9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAW