CNGA4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2118679
Article Name: CNGA4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2118679
Supplier Catalog Number: orb2118679
Alternative Catalog Number: BYT-ORB2118679-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human CNGA4
Conjugation: Biotin
Alternative Names: CNG4, CNG5, CNCA2, CNG-4, CNGB2, OCNC2, OCNCb, OCNCBETA
CNGA4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 45kDa
UniProt: Q8IV77
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RIAKLMLYIFVVIHWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQ