Ece2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2118682
Article Name: Ece2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2118682
Supplier Catalog Number: orb2118682
Alternative Catalog Number: BYT-ORB2118682-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
Conjugation: Biotin
Alternative Names: Ece2
Ece2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 86kDa
NCBI: 001002815
UniProt: Q6IE65
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YMVELGMLLGGQPTSTRAQMQQVLELEIQLATITVPQDQRRDEEKIYHKM