ERP29 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2118715
| Article Name: |
ERP29 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2118715 |
| Supplier Catalog Number: |
orb2118715 |
| Alternative Catalog Number: |
BYT-ORB2118715-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human ERP29 |
| Conjugation: |
Biotin |
| Alternative Names: |
ERp28, ERp31, PDIA9, PDI-DB, C12orf8, HEL-S-107 |
| ERP29 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
26kDa |
| NCBI: |
006808 |
| UniProt: |
P30040 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVI |
