RHOT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2118721
Article Name: RHOT1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2118721
Supplier Catalog Number: orb2118721
Alternative Catalog Number: BYT-ORB2118721-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RHOT1
Conjugation: Biotin
Alternative Names: ARHT1, MIRO1, MIRO-1
RHOT1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 001028738
UniProt: Q8IXI2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EMKPACIKALTRIFKISDQDNDGTLNDAELNFFQRICFNTPLAPQALEDV