CPT1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2118760
Article Name: CPT1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2118760
Supplier Catalog Number: orb2118760
Alternative Catalog Number: BYT-ORB2118760-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CPT1A
Conjugation: Biotin
Alternative Names: CPT1, CPT1-L, L-CPT1
CPT1A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 86kDa
NCBI: 001027017
UniProt: P50416
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN