ATP2C1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119285
Article Name: ATP2C1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119285
Supplier Catalog Number: orb2119285
Alternative Catalog Number: BYT-ORB2119285-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ATP2C1
Conjugation: Biotin
Alternative Names: HHD, BCPM, PMR1, SPCA1, hSPCA1, ATP2C1A
ATP2C1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 98kDa
NCBI: 001001485
UniProt: P98194
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TKSVFEIGLCSNRMFCYAVLGSIMGQLLVIYFPPLQKVFQTESLSILGLA