TRPM2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119306
Article Name: TRPM2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119306
Supplier Catalog Number: orb2119306
Alternative Catalog Number: BYT-ORB2119306-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRPM2
Conjugation: Biotin
Alternative Names: KNP3, EREG1, TRPC7, LTRPC2, NUDT9H, LTrpC-2, NUDT9L1
TRPM2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 171kDa
NCBI: 003298
UniProt: O94759
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VAILQALLKASRSQDHFGHENWDHQLKLAVAWNRVDIARSEIFMDEWQWK