PDE3B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119345
Article Name: PDE3B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119345
Supplier Catalog Number: orb2119345
Alternative Catalog Number: BYT-ORB2119345-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDE3B
Conjugation: Biotin
Alternative Names: HcGIP1, cGIPDE1
PDE3B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 124kDa
NCBI: 000913
UniProt: Q13370
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN