PDE3A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119348
Article Name: PDE3A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119348
Supplier Catalog Number: orb2119348
Alternative Catalog Number: BYT-ORB2119348-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDE3A
Conjugation: Biotin
Alternative Names: HTNB, CGI-PDE, CGI-PDE A, CGI-PDE-A
PDE3A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 125kDa
NCBI: 000912
UniProt: Q14432
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD