HGF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119387
Article Name: HGF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119387
Supplier Catalog Number: orb2119387
Alternative Catalog Number: BYT-ORB2119387-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HGF
Conjugation: Biotin
Alternative Names: SF, HGFB, HPTA, F-TCF, DFNB39
HGF Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 83kDa
NCBI: 001010932
UniProt: P14210
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP