HFE Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119447
Article Name: HFE Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119447
Supplier Catalog Number: orb2119447
Alternative Catalog Number: BYT-ORB2119447-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HFE
Conjugation: Biotin
Alternative Names: HH, HFE1, HLA-H, MVCD7, TFQTL2
HFE Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 40
NCBI: 000401
UniProt: Q30201
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMW