TGFBI Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119474
Article Name: TGFBI Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119474
Supplier Catalog Number: orb2119474
Alternative Catalog Number: BYT-ORB2119474-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IF, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TGFBI
Conjugation: Biotin
Alternative Names: CSD, CDB1, CDG2, CSD1, CSD2, CSD3, EBMD, LCD1, BIGH3, CDGG1
TGFBI Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 26352
UniProt: Q15582
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA