OCA2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119492
Article Name: OCA2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119492
Supplier Catalog Number: orb2119492
Alternative Catalog Number: BYT-ORB2119492-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OCA2
Conjugation: Biotin
Alternative Names: P, BEY, PED, BEY1, BEY2, BOCA, EYCL, HCL3, EYCL2, EYCL3, SHEP1, D15S12
OCA2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 93kDa
NCBI: 000266
UniProt: Q04671
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LIAEVIFTNIGGAATAIGDPPNVIIVSNQELRKMGLDFAGFTAHMFIGIC