SGCG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119516
Article Name: SGCG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119516
Supplier Catalog Number: orb2119516
Alternative Catalog Number: BYT-ORB2119516-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SGCG
Conjugation: Biotin
Alternative Names: A4, MAM, DMDA, SCG3, 35DAG, DAGA4, DMDA1, LGMD2C, LGMDR5, SCARMD2, gamma-SG
SGCG Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 000222
UniProt: Q13326
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS