GUSB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2119525
Article Name: GUSB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119525
Supplier Catalog Number: orb2119525
Alternative Catalog Number: BYT-ORB2119525-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GUSB
Conjugation: Biotin
Alternative Names: BG, MPS7
GUSB Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 72kDa
NCBI: 000172
UniProt: P08236
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF