GHR Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Catalog Number:
BYT-ORB2119532
| Article Name: |
GHR Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2119532 |
| Supplier Catalog Number: |
orb2119532 |
| Alternative Catalog Number: |
BYT-ORB2119532-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GHR |
| Conjugation: |
HRP |
| Alternative Names: |
GHBP, GHIP |
| GHR Rabbit Polyclonal Antibody (HRP) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
32kDa |
| UniProt: |
P10912 |
| Buffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Form: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequence: |
Synthetic peptide located within the following region: LLTLALAGSSDAFSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKC |