BCHE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2119565
Article Name: BCHE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119565
Supplier Catalog Number: orb2119565
Alternative Catalog Number: BYT-ORB2119565-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BCHE
Conjugation: HRP
Alternative Names: E1, CHE1, CHE2, BCHED
BCHE Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 000046
UniProt: P06276
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ