BCHE Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2119566
Article Name: BCHE Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2119566
Supplier Catalog Number: orb2119566
Alternative Catalog Number: BYT-ORB2119566-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BCHE
Conjugation: FITC
Alternative Names: E1, CHE1, CHE2, BCHED
BCHE Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 000046
UniProt: P06276
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ